Cart summary

You have no items in your shopping cart.

HSPA2 Rabbit Polyclonal Antibody (FITC)

HSPA2 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2105127

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2105127
CategoryAntibodies
DescriptionHSPA2 Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityBovine, Canine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human HSPA2
Protein SequenceSynthetic peptide located within the following region: ITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIK
UniProt IDP54652
MW70kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesHSP70-2, HSP70-3
NoteFor research use only
NCBINP_068814
  • HSPA2 Rabbit Polyclonal Antibody (FITC) [orb188553]

    ICC,  IF

    Bovine, Canine, Equine, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep

    Rabbit

    Polyclonal

    FITC

    100 μl