You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb582161 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to HSPA1L |
| Target | HSPA1L |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human, Rat |
| Predicted Reactivity | Bovine, Canine, Equine, Goat, Mouse, Porcine |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human HSPA1L |
| Protein Sequence | Synthetic peptide located within the following region: DEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD |
| UniProt ID | P34931 |
| MW | 70kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | HSP70T, hum70t, HSP70-1L, HSP70-HOM |
| Note | For research use only |
| NCBI | NP_005518 |

Sample Type: 1. Lamprey CNS (20 ug), 2. Rat Brain Lysate (20 ug), Primary dilution: 1:1000, Secondary Antibody: Goat anti-Rabbit HRP, Secondary dilution: 1:4000.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.2 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human MDA-MB-435s, Antibody dilution: 1.0 ug/ml.

HSPA1L was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb582161 with 1:200 dilution. Western blot was performed using orb582161 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: HSPA1L IP with orb582161 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

Rabbit Anti-HSPA1L antibody, Formalin Fixed Paraffin Embedded Tissue: Human Testis, Primary antibody Concentration: 1:200, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-HSPA1L Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF | |
Bovine, Human, Mouse, Porcine, Rat, Sheep, Xenopus | |
Rabbit | |
Polyclonal | |
Cy5.5 |
ICC, IF | |
Bovine, Human, Mouse, Porcine, Rat, Sheep, Xenopus | |
Rabbit | |
Polyclonal | |
Cy7 |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review