Cart summary

You have no items in your shopping cart.

HSP90AA1 Rabbit Polyclonal Antibody

SKU: orb573596

Description

Rabbit polyclonal antibody to HSP90AA1

Research Area

Cell Biology, Epigenetics & Chromatin

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Equine, Guinea pig, Rabbit, Rat, Sheep

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HSP90AA1
TargetHSP90AA1
Protein SequenceSynthetic peptide located within the following region: HLYKDLQPFILLRLLMPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIIN
Molecular Weight98kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

EL52, HSPN, LAP2, HSP86, HSPC1, HSPCA, Hsp89, Hsp90, LAP-2, HSP89A, HSP90A, HSP90N, Hsp103, HSPCAL1, HSPCAL4, HEL-S-65p

Similar Products

  • Hsp90 alpha/HSP90AA1 Rabbit Polyclonal Antibody [orb196259]

    FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Hsp90 alpha/HSP90AA1 Rabbit Polyclonal Antibody [orb315143]

    FC,  ICC,  IF,  IHC,  WB

    Human, Monkey, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • HSP 90 Polyclonal Antibody [orb1411443]

    IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • HSP90 alpha Rabbit Polyclonal Antibody [orb157592]

    ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Rat, Sheep

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • HSP 90 (Acetyl Lys292/284) rabbit pAb Antibody [orb763979]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

HSP90AA1 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.

HSP90AA1 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.

HSP90AA1 Rabbit Polyclonal Antibody

Anti-HSP90AA1 / Hsp90 antibody IHC staining of human colon, myenteric plexus. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

HSP90AA1 Rabbit Polyclonal Antibody

Anti-HSP90AA1 / Hsp90 antibody IHC staining of human tonsil. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

HSP90AA1 Rabbit Polyclonal Antibody

Rabbit Anti-HSP90AA1 Antibody, Catalog Number: orb573596, Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue, Observed Staining: Cytoplasm, Plasma membrane, Primary Antibody Concentration: 1:600, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

HSP90AA1 Rabbit Polyclonal Antibody

WB Suggested Anti-HSP90AA1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: MCF7 cell lysate, HSP90AA1 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

HSP90AA1 Rabbit Polyclonal Antibody (orb573596)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry