Cart summary

You have no items in your shopping cart.

HSF2BP Rabbit Polyclonal Antibody (FITC)

HSF2BP Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2134258

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2134258
CategoryAntibodies
DescriptionHSF2BP Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityBovine, Canine, Human, Mouse, Porcine, Rabbit, Rat
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HSF2BP
Protein SequenceSynthetic peptide located within the following region: EQLKMDCEHFKARLETVQADNIREKKEKLALRQQLNEAKQQLLQQAEYCT
UniProt IDO75031
MW38kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesPOF19, MEILB2
NoteFor research use only
NCBINP_008962
Expiration Date12 months from date of receipt.
  • HSF2BP Rabbit Polyclonal Antibody (FITC) [orb2134261]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

    Rabbit

    Polyclonal

    FITC

    100 μl