Cart summary

You have no items in your shopping cart.

HSD17B14 Rabbit Polyclonal Antibody (FITC)

HSD17B14 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2102595

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2102595
CategoryAntibodies
DescriptionHSD17B14 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityCanine, Equine, Human, Mouse, Porcine, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HSD17B14
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW28kDa
UniProt IDQ9BPX1
Protein SequenceSynthetic peptide located within the following region: RVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLD
NCBINP_057330
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesDHRS10, SDR47C1, retSDR3
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.