HSD17B11 Rabbit Polyclonal Antibody

• Catalog Number: orb577800
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HSD17B11
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
• Reactivity: Monkey
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HSD17B11
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 33kDa
• Target: HSD17B11
• UniProt ID: Q8NBQ5
• Protein Sequence: Synthetic peptide located within the following region: TGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLG
• NCBI: NP_057329
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: DHRS8, PAN1B, RETSDR2, SDR16C2, 17BHSD11, 17-BETA-
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Monkey adrenal gland, Primary Antibody Dilution: 1:25, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: Brown: HSD17B11 Blue: Nucleus, Gene Name: HSD17B11.

Sample Type: Monkey vagina, Primary Antibody Dilution: 1:25, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: Brown: HSD17B11 Blue: Nucleus, Gene Name: HSD17B11.