HSD11B1 Rabbit Polyclonal Antibody

• Catalog Number: orb579552
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HSD11B1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Sheep
• Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HSD11B1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 32kDa
• Target: HSD11B1
• UniProt ID: P28845
• Protein Sequence: Synthetic peptide located within the following region: QKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHI
• NCBI: NP_005516
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HDL, 11-DH, HSD11, HSD11B, HSD11L, CORTRD2, SDR26C
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Rodent Rat Testis, Antibody dilution: 2 ug/ml.

Positive control (+): Human Placenta (PL), Negative control (-): Human cerebral cortex, Antibody concentration: 1 ug/ml.

Sample Tissue: Rat Liver, Antibody dilution: 1 ug/ml.

Immunohistochemistry with Human Liver cell lysate tissue at an antibody concentration of 5.0 ug/ml using anti-HSD11B1 antibody (orb579552).

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 0.5, 5, and 50 ug/ml. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for either two or three concentrations were averaged and results and standard deviation are shown.

WB Suggested Anti-HSD11B1 Antibody Titration: 1 ug/ml, Positive Control: Fetal liver cell lysate.

WB Suggested Anti-HSD11B1 Antibody Titration: 2 ug/ml, Positive Control: Transient overexpression lysate of HSD11B1 and Non-overexpressed vector control lysate.