Cart summary

You have no items in your shopping cart.

HSD11B1 Rabbit Polyclonal Antibody

SKU: orb579552

Description

Rabbit polyclonal antibody to HSD11B1

Research Area

Cell Biology, Immunology & Inflammation, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Rat
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Sheep

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HSD11B1
TargetHSD11B1
Protein SequenceSynthetic peptide located within the following region: QKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHI
Molecular Weight32kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

HDL, 11-DH, HSD11, HSD11B, HSD11L, CORTRD2, SDR26C1, 11-beta-HSD1

Similar Products

  • 11β-HSD1 rabbit pAb Antibody [orb767165]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • HSD11B1 Antibody [orb675272]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
  • HSD11B1 Antibody [orb685185]

    ELISA,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • hydroxysteroid 11-beta dehydrogenase 1 Antibody [orb556184]

    ICC,  IHC-Fr,  IHC-P,  WB

    Human, Sheep

    Rabbit

    Polyclonal

    Unconjugated

  • HSD11B1 Rabbit Polyclonal Antibody [orb214059]

    IHC,  WB

    Canine, Human, Rabbit, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 30 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

HSD11B1 Rabbit Polyclonal Antibody

Sample Tissue: Rodent Rat Testis, Antibody dilution: 2 ug/ml.

HSD11B1 Rabbit Polyclonal Antibody

Positive control (+): Human Placenta (PL), Negative control (-): Human cerebral cortex, Antibody concentration: 1 ug/ml.

HSD11B1 Rabbit Polyclonal Antibody

Sample Tissue: Rat Liver, Antibody dilution: 1 ug/ml.

HSD11B1 Rabbit Polyclonal Antibody

Immunohistochemistry with Human Liver cell lysate tissue at an antibody concentration of 5.0 ug/ml using anti-HSD11B1 antibody (orb579552).

HSD11B1 Rabbit Polyclonal Antibody

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 0.5, 5, and 50 ug/ml. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for either two or three concentrations were averaged and results and standard deviation are shown.

HSD11B1 Rabbit Polyclonal Antibody

WB Suggested Anti-HSD11B1 Antibody Titration: 1 ug/ml, Positive Control: Fetal liver cell lysate.

HSD11B1 Rabbit Polyclonal Antibody

WB Suggested Anti-HSD11B1 Antibody Titration: 2 ug/ml, Positive Control: Transient overexpression lysate of HSD11B1 and Non-overexpressed vector control lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_005516

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

HSD11B1 Rabbit Polyclonal Antibody (orb579552)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry