HS6ST3 Rabbit Polyclonal Antibody

• Catalog Number: orb580642
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HS6ST3
• Target: HS6ST3
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HS6ST3
• Protein Sequence: Synthetic peptide located within the following region: TKQLEHQRDRQKRREERRLQREHRDHQWPKEDGAAEGTVTEDYNSQVVRW
• UniProt ID: Q8IZP7
• MW: 55kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: HS6ST-3
• Note: For research use only
• NCBI: NP_703157

Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.

WB Suggested Anti-HS6ST3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human brain.