Cart summary

You have no items in your shopping cart.

HS3ST1 Rabbit Polyclonal Antibody (FITC)

HS3ST1 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2137842

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2137842
CategoryAntibodies
DescriptionHS3ST1 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human HS3ST1
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW34kDa
UniProt IDO14792
Protein SequenceSynthetic peptide located within the following region: TKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELV
NCBINP_005105
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative names3OST, 3OST1
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.