HPV11 E6 Antibody

SKU: orb153333

Description

Goat polyclonal antibody to HPV11 E6. E6 is one primary oncoprotein of high risk HPV types expressed early in the HPV life cycle. After the host cell is infected viral early promoter is activated and a polycistronic primary RNA containing all six early ORFs is transcribed. This polycistronic RNA then undergoes active RNA splicing to generate multiple isoforms of mRNAs. One of the spliced isoform RNAs, E6, serves as an E7 mRNA to translate E7 protein. HPV genome integrate into host genome by disruption of E2 ORF, preventing E2 repression on E6 and E7. Thus, viral genome integration into host DNA genome increases E6 expression. The E6 protein inactivates the tumour suppressor protein, p53 and promote cellular proliferation and the chance of malignancy.

Images & Validation

• Tested Applications: WB
• Dilution range: WB:1:500-1:2,000
• Reactivity: Virus
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Antibody Type: Primary Antibody
• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 65 aa to N-terminal of HPV11 E6 produced in E. coli.. Antigen Sequence: MESKDASTSATSIDQLCKTFNLSLHTLQIQCVFCRNALTTAEIYAYAYKNLKVVWRDNFPFAACA
• Target: HPV11 E6
• Purification: Epitope affinity purified

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Concentration: 1 mg/ml
• Disclaimer: For research use only

Western blot analysis of HEK293 cell line lysate and MBP-E6 (N-term) recombinant protein using HPV11 E6 antibody.

Quick Database Links

Gene Symbol

HPV11 E6