Cart summary

You have no items in your shopping cart.

HPS6 Rabbit Polyclonal Antibody (FITC)

HPS6 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2091369

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2091369
CategoryAntibodies
DescriptionHPS6 Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityHuman
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human HPS6
Protein SequenceSynthetic peptide located within the following region: GARVVAVAALRGRLVWCEERQARAEGPSGSPAAAFSHCVCVRTLEPSGEA
UniProt IDQ86YV9
MW85kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesBLOC2S3
NoteFor research use only
NCBINP_079023