Cart summary

You have no items in your shopping cart.

HPS1 Rabbit Polyclonal Antibody (HRP)

HPS1 Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2083430

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2083430
CategoryAntibodies
DescriptionHPS1 Rabbit Polyclonal Antibody (HRP)
ClonalityPolyclonal
Species/HostRabbit
ConjugationHRP
Predicted ReactivityHuman
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human HPS1
Protein SequenceSynthetic peptide located within the following region: PSRGGPHLPQHLQDQVQRLMREKLTDWKDFLLVKSRRNITMVSYLEDFPG
UniProt IDQ92902
MW73kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesHPS, BLOC3S1
NoteFor research use only
NCBIXP_005269815
  • HPS1 Rabbit Polyclonal Antibody (HRP) [orb477088]

    ELISA,  IHC-Fr,  IHC-P

    Bovine, Equine, Human, Mouse, Rat

    Rabbit

    Polyclonal

    HRP

    100 μl