You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575066 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to HOXB7 |
Target | HOXB7 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Mouse, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Protein A purified |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human HOXB7 |
Protein Sequence | Synthetic peptide located within the following region: IEIAHTLCLTERQIKIWFQNRRMKWKKENKTAGPGTTGQDRAEAEEEEEE |
UniProt ID | P09629 |
MW | 24kDa |
Tested applications | IF, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | HOX2, HOX2C, HHO.C1, Hox-2.3 |
Research Area | Epigenetics & Chromatin, Molecular Biology, Stem C Read more... |
Note | For research use only |
NCBI | NP_004493 |
Expiration Date | 12 months from date of receipt. |
Sample Type: HCT116, Primary Antibody dilution: 4 ug/ml, Secondary Antibody: Anti-rabbit Alexa 546, Secondary Antibody dilution: 2 ug/ml, Gene Name: HOXB7.
Sample Type: SKOV3, Primary Antibody dilution: 4 ug/ml, Secondary Antibody: Anti-rabbit Alexa 546, Secondary Antibody dilution: 2 ug/ml, Gene Name: HOXB7.
WB Suggested Anti-HOXB7 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:62500, Positive Control: Transfected 293T.
IHC-P, WB | |
Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |