HOXB7 Rabbit Polyclonal Antibody

• Catalog Number: orb575066
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HOXB7
• Target: HOXB7
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HOXB7
• Protein Sequence: Synthetic peptide located within the following region: IEIAHTLCLTERQIKIWFQNRRMKWKKENKTAGPGTTGQDRAEAEEEEEE
• UniProt ID: P09629
• MW: 24kDa
• Tested applications: IF, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: HOX2, HOX2C, HHO.C1, Hox-2.3
• Note: For research use only
• NCBI: NP_004493

Sample Type: HCT116, Primary Antibody dilution: 4 ug/ml, Secondary Antibody: Anti-rabbit Alexa 546, Secondary Antibody dilution: 2 ug/ml, Gene Name: HOXB7.

Sample Type: SKOV3, Primary Antibody dilution: 4 ug/ml, Secondary Antibody: Anti-rabbit Alexa 546, Secondary Antibody dilution: 2 ug/ml, Gene Name: HOXB7.

WB Suggested Anti-HOXB7 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:62500, Positive Control: Transfected 293T.