HOXA5 antibody

• Catalog Number: orb330051
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HOXA5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HOXA5
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 29 kDa
• Target: HOXA5
• UniProt ID: A2D5Y4
• Protein Sequence: Synthetic peptide located within the following region: FNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSMAAAG
• NCBI: NP_061975
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti HOX1 antibody, anti HOX1.3 antibody, anti HOX
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemical staining of human breast tissue using HOXA5 antibody

Immunohistochemical staining of human Breast tissue using HOXA5 antibody

Western blot analysis of human Placenta tissue using HOXA5 antibody

Immunohistochemical staining of human Kidney tissue using HOXA5 antibody