Cart summary

You have no items in your shopping cart.

HOXA5 Rabbit Polyclonal Antibody

SKU: orb330051

Description

Rabbit polyclonal antibody to HOXA5

Research Area

Cell Biology, Epigenetics & Chromatin, Immunology & Inflammation, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human HOXA5
TargetHOXA5
Protein SequenceSynthetic peptide located within the following region: FNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSMAAAG
Molecular Weight29 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti HOX1 antibody, anti HOX1.3 antibody, anti HOX1C antibody, anti MGC9376 antibody

Similar Products

  • HOXA5 Rabbit Polyclonal Antibody [orb329606]

    IHC,  WB

    Bovine, Canine, Equine, Porcine, Rabbit, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • HOXA5 Antibody [orb1319961]

    ELISA,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • HoxA5 rabbit pAb Antibody [orb768635]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • HOXA5 Rabbit Polyclonal Antibody (Biotin) [orb446947]

    ELISA,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Gallus, Human, Mouse, Porcine, Rabbit, Rat, Sheep

    Rabbit

    Polyclonal

    Biotin

    100 μl
  • HOXA5 Antibody (C-term E211) [orb1429635]

    FC,  WB

    Drosophila, Other, Rat, Sheep, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    80 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

HOXA5 Rabbit Polyclonal Antibody

Sample Tissue: Human RPMI 8226 Whole Cell, Antibody Dilution: 5 ug/mL.

HOXA5 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.

HOXA5 Rabbit Polyclonal Antibody

Anti-HOXA5 antibody IHC staining of human breast. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL.

HOXA5 Rabbit Polyclonal Antibody

Anti-HOXA5 antibody IHC staining of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL.

HOXA5 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/mL.

HOXA5 Rabbit Polyclonal Antibody

Positive control (+): THP-1 (N30), Negative control (-): HeLa (HL), Antibody concentration: 1 ug/mL.

HOXA5 Rabbit Polyclonal Antibody

Rabbit Anti-HOXA5 Antibody, Paraffin Embedded Tissue: Human Breast, Antibody Concentration: 5 ug/mL.

HOXA5 Rabbit Polyclonal Antibody

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

HOXA5 Rabbit Polyclonal Antibody

WB Suggested Anti-HOXA5 Antibody Titration: 1 ug/mL, Positive Control: Placenta.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_061975

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

HOXA5 Rabbit Polyclonal Antibody (orb330051)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry