HOXA5 Rabbit Polyclonal Antibody

• Catalog Number: orb329606
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HOXA5
• Target: HOXA5
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HOXA5
• Protein Sequence: Synthetic peptide located within the following region: VGTASGAEEDAPASSEQASAQSEPSPAPPAQPQIYPWMRKLHISHDNIGG
• UniProt ID: Q6FG31
• MW: 29kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti HOX1 antibody, anti HOX1.3 antibody, anti HOX
• Note: For research use only
• NCBI: NP_061975

Human kidney

Sample Type: Mouse dorsal skin -5d postnatal, Primary Antibody Dilution: 1:200, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: Brown: HOXA5, Gene Name: HOXA5.

WB Suggested Anti-HOXA5 Antibody Titration: 0.2-1 ug/mL, Positive Control: 721_B cell lysate.