You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb592869 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to HOXA10 |
Target | HOXA10 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Canine, Mouse, Rabbit |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HOXA10 |
Protein Sequence | Synthetic peptide located within the following region: MSCSESPAANSFLVDSLISSGRGEAGGGGGGAGGGGGGGYYAHGGVYLPP |
UniProt ID | P31260 |
MW | 41kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | PL, HOX1, HOX1H, HOX1.8 |
Note | For research use only |
NCBI | NP_061824 |
Human Muscle
WB Suggested Anti-HOXA10 Antibody Titration: 1.25 ug/ml, Positive Control: HepG2 cell lysate.
FC, IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Canine, Rabbit | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Mouse, Porcine, Rabbit | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |