HOMER1 Rabbit Polyclonal Antibody

• Catalog Number: orb577471
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HOMER1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HOMER1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 39kDa
• Target: HOMER1
• UniProt ID: Q86YM7
• Protein Sequence: Synthetic peptide located within the following region: EKFQEFKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPLTPESINGTDD
• NCBI: NP_004263
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HOMER, SYN47, Ves-1, HOMER1A, HOMER1B, HOMER1C
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/ml.

Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/ml.

WB Suggested Anti-HOMER1 Antibody Titration: 0.0156 ug/ml, ELISA Titer: 1:62500, Positive Control: Transfected 293T.