Cart summary

You have no items in your shopping cart.

HNRPL Rabbit Polyclonal Antibody

Catalog Number: orb577552

Select Product Size
SizePriceQuantity
100 μl$ 600.00
100 μl Enquire
DispatchUsually dispatched within 3-7 working days
Product Properties
Catalog Numberorb577552
CategoryAntibodies
DescriptionRabbit polyclonal antibody to HNRPL
TargetHNRNPL
ClonalityPolyclonal
Species/HostRabbit
ConjugationUnconjugated
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
PurificationAffinity Purified
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HNRPL
Protein SequenceSynthetic peptide located within the following region: AAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYV
UniProt IDP14866
MW65kDa
Tested applicationsIF, IHC, IP, WB
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Alternative namesHNRPL, hnRNP-L, P/OKcl.14
Research AreaEpigenetics & Chromatin, Molecular Biology
NoteFor research use only
NCBINP_001524
Expiration Date12 months from date of receipt.
Images
HNRPL Rabbit Polyclonal Antibody

Amount and Sample Type: Lane 1: 5% Input, Lane 2: 5% Sup, Lane 3: Normal IgG, Lane 4: hn-RNPL ppt. k562 sample, IP Antibody: HNRPL, Amount of IP Antibody, Primary Antibody: HNRPL, Primary Antibody Dilution: 1:4000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: HNRPL.

HNRPL Rabbit Polyclonal Antibody

Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/ml.

HNRPL Rabbit Polyclonal Antibody

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/ml.

HNRPL Rabbit Polyclonal Antibody

Lane 1: 20 ug HeLa S3 lysate, Lane 2: 20 ug MCF7 lysate, Lane 3: 20 ug K562 lysate, Primary Antibody Dilution: 1:4000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: HNRPL.

HNRPL Rabbit Polyclonal Antibody

Rabbit Anti-HNRPL antibody, Paraffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

HNRPL Rabbit Polyclonal Antibody

Rabbit Anti-HNRPL Antibody, Paraffin Embedded Tissue: Human Liver, Cellular Data: Hepatocytes, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

HNRPL Rabbit Polyclonal Antibody

Sample Type: MCF7 cells, Primary Antibody Dilution: 1:200, Secondary Antibody: Anti-rabbit-FITC, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: DAPI: Blue hnRNPL: Green, Gene Name: HNRPL.

HNRPL Rabbit Polyclonal Antibody

WB Suggested Anti-HNRPL Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate. HNRNPL is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.

Similar Products
  • hnRNP L rabbit pAb [orb765427]

    ELISA,  IF,  IHC-P,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • HNRPL Rabbit Polyclonal Antibody [orb577504]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • HNRNPL Antibody [orb685498]

    ELISA,  IF,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • HNRPL Rabbit Polyclonal Antibody [orb577551]

    IHC,  WB

    Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • HNRNPL Antibody [orb675625]

    ELISA,  IF,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
Reviews

HNRPL Rabbit Polyclonal Antibody (orb577552)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet