Cart summary

You have no items in your shopping cart.

HNRPL Rabbit Polyclonal Antibody

SKU: orb577552

Description

Rabbit polyclonal antibody to HNRPL

Research Area

Epigenetics & Chromatin, Molecular Biology

Images & Validation

Tested ApplicationsIF, IHC, IP, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HNRPL
TargetHNRNPL
Protein SequenceSynthetic peptide located within the following region: AAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYV
Molecular Weight65kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

HNRPL, hnRNP-L, P/OKcl.14

Similar Products

  • hnRNP L/HNRNPL Rabbit Polyclonal Antibody [orb1290006]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • HnRNP L/HNRNPL Rabbit Polyclonal Antibody [orb389416]

    ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • hnRNP L rabbit pAb Antibody [orb765427]

    ELISA,  IF,  IHC,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • HNRNPL Antibody [orb685498]

    ELISA,  IF,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • HNRPL Rabbit Polyclonal Antibody [orb577504]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

HNRPL Rabbit Polyclonal Antibody

Amount and Sample Type: Lane 1: 5% Input, Lane 2: 5% Sup, Lane 3: Normal IgG, Lane 4: hn-RNPL ppt. k562 sample, IP Antibody: HNRPL, Amount of IP Antibody, Primary Antibody: HNRPL, Primary Antibody Dilution: 1:4000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: HNRPL.

HNRPL Rabbit Polyclonal Antibody

Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/ml.

HNRPL Rabbit Polyclonal Antibody

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/ml.

HNRPL Rabbit Polyclonal Antibody

Lane 1: 20 ug HeLa S3 lysate, Lane 2: 20 ug MCF7 lysate, Lane 3: 20 ug K562 lysate, Primary Antibody Dilution: 1:4000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: HNRPL.

HNRPL Rabbit Polyclonal Antibody

Rabbit Anti-HNRPL antibody, Paraffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

HNRPL Rabbit Polyclonal Antibody

Rabbit Anti-HNRPL Antibody, Paraffin Embedded Tissue: Human Liver, Cellular Data: Hepatocytes, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

HNRPL Rabbit Polyclonal Antibody

Sample Type: MCF7 cells, Primary Antibody Dilution: 1:200, Secondary Antibody: Anti-rabbit-FITC, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: DAPI: Blue hnRNPL: Green, Gene Name: HNRPL.

HNRPL Rabbit Polyclonal Antibody

WB Suggested Anti-HNRPL Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate. HNRNPL is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_001524

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol
IF
Immunofluorescence
View Protocol
IP
Immunoprecipitation
View Protocol

HNRPL Rabbit Polyclonal Antibody (orb577552)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry