HNRNPH3 antibody

• Catalog Number: orb324892
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HNRNPH3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HNRPH3
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 38 kDa
• Target: HNRNPH3
• UniProt ID: P31942
• Protein Sequence: Synthetic peptide located within the following region: DYQGRSTGEAFVQFASKEIAENALGKHKERIGHRYIEIFRSSRSEIKGFY
• NCBI: NP_036339
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti 2H9 antibody, anti HNRPH3 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemical staining of human Lung tissue using HNRNPH3 antibody

Western blot analysis of Raji cell lysate tissue using HNRNPH3 antibody

Immunohistochemical staining of human Kidney tissue using HNRNPH3 antibody