You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | ICC, IF, IP, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human HNRPH1 |
| Target | HNRNPH1 |
| Protein Sequence | Synthetic peptide located within the following region: FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG |
| Molecular Weight | 49 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−HnRNP H/HNRNPH1 Rabbit Polyclonal Antibody [orb389415]
FC, ICC, IF, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μgHNRNPH1 Rabbit Polyclonal Antibody [orb627762]
ELISA, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μghnRNP H1 Rabbit Polyclonal Antibody [orb666917]
IF, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl, 200 μlhnRNP H Rabbit Polyclonal Antibody [orb214044]
IHC, WB
Bovine, Gallus, Human
Rabbit
Polyclonal
Unconjugated
30 μl, 100 μl, 200 μl, 50 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.

Amount and Sample Type: Lane 1: 5% Input, Lane 2: 5% Sup, Lane 3: Normal IgG, Lane 4: hn-RNPH1 ppt. k562 sample, IP Antibody: HNRPH1, Amount of IP Antibody, Primary Antibody: HNRPH1, Primary Antibody Dilution: 1:4000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: HNRPH1.

Sample Type: 721_B, Antibody Dilution: 1.0 ug/mL, HNRNPH1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Sample Type: Jurkat, Antibody Dilution: 1.0 ug/mL, HNRNPH1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.

Sample Type: MCF7, Antibody Dilution: 1.0 ug/mL, HNRNPH1 is strongly supported by BioGPS gene expression data to be expressed in MCF7.

IHC Information: Paraffin embedded testis tissue, tested with an antibody Dilution of 5 ug/mL.

Lanes: Lane 1: 20 ug HeLa S3 lysate Lane 2: 20 ug MCF7 lysate Lane 3: 20 ug K562 lysate, Primary Antibody Dilution: 1:4000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: HNRPH1.

Sample Type: MCF7 cells, Primary Antibody Dilution: 1:200, Secondary Antibody: Anti-rabbit-FITC, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: DAPI: Blue HNRNPH1: Green, Gene Name: HNRPH1.

WB Suggested Anti-HNRPH1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate, HNRNPH1 is supported by BioGPS gene expression data to be expressed in HepG2.
Documents Download
Request a Document
Protocol Information
HNRPH1 Rabbit Polyclonal Antibody (orb326259)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review























