HNRPH1 Rabbit Polyclonal Antibody

• Catalog Number: orb326259
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HNRNPH1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ICC, IF, IP, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HNRPH1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 49 kDa
• Target: HNRNPH1
• UniProt ID: P31943
• Protein Sequence: Synthetic peptide located within the following region: FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG
• NCBI: NP_005511
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti DKFZp686A15170 antibody, anti HNRPH antibody,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.

Amount and Sample Type: Lane 1: 5% Input, Lane 2: 5% Sup, Lane 3: Normal IgG, Lane 4: hn-RNPH1 ppt. k562 sample, IP Antibody: HNRPH1, Amount of IP Antibody, Primary Antibody: HNRPH1, Primary Antibody Dilution: 1:4000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: HNRPH1.

Sample Type: 721_B, Antibody Dilution: 1.0 ug/mL, HNRNPH1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Sample Type: Jurkat, Antibody Dilution: 1.0 ug/mL, HNRNPH1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.

Sample Type: MCF7, Antibody Dilution: 1.0 ug/mL, HNRNPH1 is strongly supported by BioGPS gene expression data to be expressed in MCF7.

IHC Information: Paraffin embedded testis tissue, tested with an antibody Dilution of 5 ug/mL.

Lanes: Lane 1: 20 ug HeLa S3 lysate Lane 2: 20 ug MCF7 lysate Lane 3: 20 ug K562 lysate, Primary Antibody Dilution: 1:4000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: HNRPH1.

Sample Type: MCF7 cells, Primary Antibody Dilution: 1:200, Secondary Antibody: Anti-rabbit-FITC, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: DAPI: Blue HNRNPH1: Green, Gene Name: HNRPH1.

WB Suggested Anti-HNRPH1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate, HNRNPH1 is supported by BioGPS gene expression data to be expressed in HepG2.