HNRPA3 Rabbit Polyclonal Antibody

SKU: orb324945

Description

Rabbit polyclonal antibody to HNRNPA3

Research Area

Molecular Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HNRPA3
• Target: HNRNPA3
• Protein Sequence: Synthetic peptide located within the following region: MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDS
• Molecular Weight: 42kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti FBRNP antibody, anti HNRPA3 antibody, anti D10S102 antibody, anti 2610510D13Rik antibody

Sample Tissue: Human Jurkat, Antibody Dilution: 1.0 ug/mL.

Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 0.625 ug/mL, Peptide Concentration: 1.0 ug/mL, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.

Positive control (+): HeLa Cell Lysate (HL), Negative control (-): Human Fetal Heart (HE), Antibody concentration: 3 ug/mL.

Rabbit Anti-HNRPA3 Antibody, Paraffin Embedded Tissue: Human Liver, Cellular Data: Hepatocytes, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

Rabbit Anti-HNRPA3 Antibody, Paraffin Embedded Tissue: Human Lung, Cellular Data: Alveolar cells, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-HNRPA3 antibody Titration: 1 ug/mL, Sample Type: Human 721_B.

WB Suggested Anti-HNRPA3 antibody Titration: 1 ug/mL, Sample Type: Human Daudi.

WB Suggested Anti-HNRPA3 Antibody Titration: 1.25 ug/mL, Positive Control: Jurkat cell lysate, HNRNPA3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.

Quick Database Links

Gene Symbol

HNRNPA3

UniProt

P51991

RefSeq (Protein):NP_919223