Cart summary

You have no items in your shopping cart.

HNF4A Rabbit Polyclonal Antibody

SKU: orb329630

Description

Rabbit polyclonal antibody to HNF4A

Research Area

Cell Biology, Epigenetics & Chromatin, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Rat
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Sheep, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human HNF4A
TargetHNF4A
Protein SequenceSynthetic peptide located within the following region: MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNA
Molecular Weight53kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti HNF4 antibody, anti HNF4a7 antibody, anti HNF4a8 antibody, anti HNF4a9 antibody, anti HNF4alpha antibody, anti MODY antibody, anti MODY1 antibody, anti NR2A1 antibody, anti NR2A21 antibody, anti TCF antibody, anti TCF14 antibody

Similar Products

  • HNF4A Rabbit Polyclonal Antibody [orb5453]

    IF,  IHC-Fr,  IHC-P,  WB

    Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • HNF4-α (phospho Ser313) rabbit pAb Antibody [orb764399]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • HNF1A Rabbit Polyclonal Antibody [orb583768]

    WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • HNF1A Rabbit Polyclonal Antibody [orb10829]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Gallus, Porcine, Sheep, Zebrafish

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 100 μl, 50 μl
  • HNF1 alpha antibody [N1N3] [orb556884]

    ICC,  IHC-P,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

HNF4A Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Several isoforms contain the peptide sequence in the range of 57 kDa to 46 kDa, and the protein may be ubiquitinated as well as phosphorylated.

HNF4A Rabbit Polyclonal Antibody

Sample Tissue: Human Lung Tumor, Antibody Dilution: 1.0 ug/mL.

HNF4A Rabbit Polyclonal Antibody

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

HNF4A Rabbit Polyclonal Antibody

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

HNF4A Rabbit Polyclonal Antibody

Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/mL.

HNF4A Rabbit Polyclonal Antibody

WB Suggested Anti-HNF4A Antibody Titration: 0.2-1 ug/mL. A: - blocking peptide. B: + blocking peptide.

HNF4A Rabbit Polyclonal Antibody

WB Suggested Anti-HNF4A antibody Titration: 1 ug/mL, Sample Type: Human Liver.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000448

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

HNF4A Rabbit Polyclonal Antibody (orb329630)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry