You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb329630 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to HNF4A |
| Target | HNF4A |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human, Rat |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Sheep, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human HNF4A |
| Protein Sequence | Synthetic peptide located within the following region: MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNA |
| UniProt ID | P41235 |
| MW | 53kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti HNF4 antibody, anti HNF4a7 antibody, anti HNF Read more... |
| Research Area | Cell Biology, Epigenetics & Chromatin, Signal Tran Read more... |
| Note | For research use only |
| NCBI | NP_000448 |

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Several isoforms contain the peptide sequence in the range of 57 kDa to 46 kDa, and the protein may be ubiquitinated as well as phosphorylated.

Sample Tissue: Human Lung Tumor, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/mL.

WB Suggested Anti-HNF4A Antibody Titration: 0.2-1 ug/mL. A: - blocking peptide. B: + blocking peptide.

WB Suggested Anti-HNF4A antibody Titration: 1 ug/mL, Sample Type: Human Liver.
IF, IHC-Fr, IHC-P, WB | |
Mouse, Rat | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review