HNF4A antibody

• Catalog Number: orb329630
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HNF4A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat, Sheep, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human HNF4A
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 53kDa
• Target: HNF4A
• UniProt ID: P41235
• Protein Sequence: Synthetic peptide located within the following region: MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNA
• NCBI: NP_000448
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti HNF4 antibody, anti HNF4a7 antibody, anti HNF
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human Liver tissue using HNF4A antibody

Western blot analysis of human Liver tissue using HNF4A antibody

Western blot analysis of human Fetal Heart tissue using HNF4A antibody

Western blot analysis of human Fetal Lung tissue using HNF4A antibody