HNF1A Rabbit Polyclonal Antibody

• Catalog Number: orb573725
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HNF1A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human HNF1A
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 49kDa
• Target: HNF1A
• UniProt ID: P20823
• Protein Sequence: Synthetic peptide located within the following region: QTMLITDTTNLSALASLTPTKQVFTSDTEASSESGLHTPASQATTLHVPS
• NCBI: NP_000536.5
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HNF1, LFB1, TCF1, HNF4A, MODY3, TCF-1, HNF-1A, IDD
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: 293T Whole Cell lysates, Antibody dilution: 1.0 ug/ml.