You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579414 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to HMOX1 |
Target | HMOX1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Bovine, Canine, Goat, Guinea pig, Porcine, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human HMOX1 |
Protein Sequence | Synthetic peptide located within the following region: ERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVM |
UniProt ID | P09601 |
MW | 33kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | HO-1, HSP32, HMOX1D, bK286B10 |
Note | For research use only |
NCBI | NP_002124 |
HMOX1 antibody - N-terminal region (orb579414) validated by WB using tonsil and fibroblast at 1:1000.
Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/ml.
Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/ml.
Sample Type: Jurkat Whole Cell lysates, Antibody Dilution: 1.0 ug/ml.
Rabbit Anti-HMOX1 Antibody, Catalog Number: orb579414, Formalin Fixed Paraffin Embedded Tissue: Human Ovary Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Gallus, Guinea pig, Rabbit, Sheep | |
Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |