HMGCS1 Rabbit Polyclonal Antibody

• Catalog Number: orb580448
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HMGCS1
• Target: HMGCS1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HMGCS1
• Protein Sequence: Synthetic peptide located within the following region: KDFTLNDFGFMIFHSPYCKLVQKSLARMLLNDFLNDQNRDKNSIYSGLEA
• UniProt ID: Q01581
• MW: 57 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: HMGCS
• Research Area: Cell Biology, Immunology & Inflammation, Signal Tr
• Note: For research use only
• NCBI: NP_002121

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Isoforms containing the peptide sequence are found at ~53 kDa and ~36 kDa.

Positive control (+): THP-1 (N30), Negative control (-): HeLa (HL), Antibody concentration: 3 ug/ml.

Immunohistochemistry with Human Skeletal Muscle lysate tissue at an antibody concentration of 5.0 ug/ml using anti-HMGCS1 antibody (orb580448).

WB Suggested Anti-HMGCS1 Antibody Titration: 1 ug/ml, Positive Control: 293T cells lysate. HMGCS1 is supported by BioGPS gene expression data to be expressed in HEK293T.