You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb585531 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to HLA-G |
| Target | HLA-G |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Porcine |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Protein Sequence | Synthetic peptide located within the following region: HPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTF |
| UniProt ID | P17693 |
| MW | 36kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | MHC-G |
| Research Area | Molecular Biology, Stem Cell & Developmental Biolo Read more... |
| Note | For research use only |
| NCBI | NP_002118 |

WB Suggested Anti-HLA-G Antibody, Titration: 1.0 ug/ml, Positive Control: RPMI-8226 Whole Cell. HLA-G is strongly supported by BioGPS gene expression data to be expressed in RPMI-8226.
IF, IHC-Fr, IHC-P, WB | |
Rat | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-Fr, IHC-P, WB | |
Human, Rat | |
Rabbit | |
Polyclonal | |
AP |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review