HK2 Rabbit Polyclonal Antibody

• Catalog Number: orb330743
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HK2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HK2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 102kDa
• Target: HK2
• UniProt ID: P52789
• Protein Sequence: Synthetic peptide located within the following region: GTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSG
• NCBI: NP_000180
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti DKFZp686M1669 antibody, anti HKII antibody, a
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Positive control (+): Mouse Testis (M-TE), Negative control (-): Mouse Small Intestine (M-IN), Antibody concentration: 1 ug/ml.

Immunohistochemistry with Human Skeletal Muscle lysate tissue at an antibody concentration of 5.0 ug/ml using anti-HK2 antibody (orb330743).

Lanes: 1: 50 ug HEP3B lysate, 2: 50 ug HEP3B lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:1000, Gene Name: HK2.

Rabbit Anti-HK2 Antibody, Catalog Number: orb330743, Formalin Fixed Paraffin Embedded Tissue: Human Testis Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-HK2 Antibody Titration: 1 ug/ml, Positive Control: 721_B cell lysate, HK2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.