Cart summary

You have no items in your shopping cart.

HIPK2 Rabbit Polyclonal Antibody

SKU: orb574278

Description

Rabbit polyclonal antibody to HIPK2

Research Area

Cell Biology

Images & Validation

Tested ApplicationsIHC-P, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human HIPK2
TargetHIPK2
Protein SequenceSynthetic peptide located within the following region: MWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTR
Molecular Weight120kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

PRO0593

Similar Products

  • HIPK2 Rabbit Polyclonal Antibody [orb100602]

    IF,  IHC-Fr,  IHC-P,  WB

    Canine, Gallus, Porcine, Rabbit, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl
  • HIPK2 Rabbit Polyclonal Antibody [orb215143]

    WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    30 μl, 100 μl, 200 μl, 50 μl
  • HIPK2 polyclonal antibody [orb645376]

    WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 100 μl, 50 μl
  • HIPK2 Rabbit pAb, PerCP-Cy7 conjugated [orb2844954]

    IF

    Canine, Gallus, Porcine, Rabbit, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    PerCP/Cy7

    100 μl
  • HIPK2 Rabbit pAb, Pacific Blue conjugated [orb2844955]

    IF

    Canine, Gallus, Porcine, Rabbit, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Pacific Blue

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

HIPK2 Rabbit Polyclonal Antibody

HIPK2 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb574278 with 1:200 dilution. Western blot was performed using orb574278 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate. Lane 2: HIPK2 IP with orb574278 in HEK293 Whole Cell Lysate. Lane 3: Input of HEK293 Whole Cell Lysate.

HIPK2 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml.

HIPK2 Rabbit Polyclonal Antibody

Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 1 ug/ml.

HIPK2 Rabbit Polyclonal Antibody

Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1.0 ug/ml, Peptide Concentration: 1.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 6%-18%. HIPK2 is supported by BioGPS gene expression data to be expressed in HepG2.

HIPK2 Rabbit Polyclonal Antibody

Rabbit Anti-HIPK2 Antibody, Catalog Number: orb574278, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Nuclear in pinealocytes & intersticial cells, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

HIPK2 Rabbit Polyclonal Antibody

Rabbit Anti-HIPK2 Antibody, Catalog Number: orb574278, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Nuclear, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

HIPK2 Rabbit Polyclonal Antibody

Rabbit Anti-HIPK2 Antibody, Paraffin Embedded Tissue: Human cardiac cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

HIPK2 Rabbit Polyclonal Antibody

Rabbit Anti-HIPK2 Antibody, Paraffin Embedded Tissue: Human neural cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

HIPK2 Rabbit Polyclonal Antibody

Rabbit Anti-HIPK2 Antibody, Paraffin Embedded Tissue: Human Heart, Cellular Data: Myocardial cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

HIPK2 Rabbit Polyclonal Antibody

WB Suggested Anti-HIPK2 Antibody Titration: 0.06 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate, HIPK2 is supported by BioGPS gene expression data to be expressed in HepG2.

HIPK2 Rabbit Polyclonal Antibody

WB Suggested Anti-HIPK2 Antibody Titration: 0.1 ug/ml, Positive Control: Jurkat cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_073577

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC-P
Immunohistochemistry Paraffin
View Protocol

HIPK2 Rabbit Polyclonal Antibody (orb574278)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry