You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574278 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to HIPK2 |
Target | HIPK2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human HIPK2 |
Protein Sequence | Synthetic peptide located within the following region: MWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTR |
UniProt ID | Q9H2X6 |
MW | 120kDa |
Tested applications | IHC-P, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | PRO0593 |
Note | For research use only |
NCBI | NP_073577 |
HIPK2 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb574278 with 1:200 dilution. Western blot was performed using orb574278 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate. Lane 2: HIPK2 IP with orb574278 in HEK293 Whole Cell Lysate. Lane 3: Input of HEK293 Whole Cell Lysate.
Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml.
Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 1 ug/ml.
Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1.0 ug/ml, Peptide Concentration: 1.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 6%-18%. HIPK2 is supported by BioGPS gene expression data to be expressed in HepG2.
Rabbit Anti-HIPK2 Antibody, Catalog Number: orb574278, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Nuclear in pinealocytes & intersticial cells, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
Rabbit Anti-HIPK2 Antibody, Catalog Number: orb574278, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Nuclear, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
Rabbit Anti-HIPK2 Antibody, Paraffin Embedded Tissue: Human cardiac cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
Rabbit Anti-HIPK2 Antibody, Paraffin Embedded Tissue: Human neural cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
Rabbit Anti-HIPK2 Antibody, Paraffin Embedded Tissue: Human Heart, Cellular Data: Myocardial cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-HIPK2 Antibody Titration: 0.06 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate, HIPK2 is supported by BioGPS gene expression data to be expressed in HepG2.
WB Suggested Anti-HIPK2 Antibody Titration: 0.1 ug/ml, Positive Control: Jurkat cell lysate.
IF, IHC-Fr, IHC-P, WB | |
Canine, Gallus, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
DOT, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |