You have no items in your shopping cart.
Cart summary
Item 1 of 1
HHIPL1 Rabbit Polyclonal Antibody
Catalog Number: orb584479
Product Properties
| Catalog Number | orb584479 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to HHIPL1 |
| Target | HHIPL1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human HHIPL1 |
| Protein Sequence | Synthetic peptide located within the following region: EFGQGGSLPILLDDVRCAGWERNLLECQHNGVGTHNCEHDEDAGVVCSHQ |
| UniProt ID | Q96JK4 |
| MW | 85kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | UNQ9245, KIAA1822 |
| Research Area | Epigenetics |
| Note | For research use only |
| NCBI | NP_001120730 |
Images
WB Suggested Anti-HHIPL1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: MDA-MB-435S cell lysate.
Similar Products
Reviews
HHIPL1 Rabbit Polyclonal Antibody (orb584479)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review