HEYL Rabbit Polyclonal Antibody

• Catalog Number: orb573937
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HEYL
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HEYL
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 35kDa
• Target: HEYL
• UniProt ID: Q9NQ87
• Protein Sequence: Synthetic peptide located within the following region: MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKRRGI
• NCBI: NP_055386
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HEY3, HRT3, HESR3, bHLHb33
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Positive control (+): 293T (2T), Negative control (-): HepG2 (HG), Antibody concentration: 3 ug/ml.

WB Suggested Anti-HEYL Antibody Titration: 1.0 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Muscle.