HERC6 Rabbit Polyclonal Antibody

• Catalog Number: orb578763
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HERC6
• Target: HERC6
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HERC6
• Protein Sequence: Synthetic peptide located within the following region: LSKDSQVFSWGKNSHGQLGLGKEFPSQASPQRVRSLEGIPLAQVAAGGAH
• UniProt ID: Q8IVU3
• MW: 115kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: FLJ20637
• Note: For research use only
• NCBI: NP_060382

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present at 111 kDa.

HERC6 antibody - N-terminal region (orb578763) validated by WB using hek293 cell lysate at 1:1000. HERC6 is supported by BioGPS gene expression data to be expressed in HEK293.

WB Suggested Anti-HERC6 Antibody Titration: 0.2-1 ug/ml, Positive Control: ACHN cell lysate.