You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577672 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to HDLBP |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HDLBP |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 141kDa |
Target | HDLBP |
UniProt ID | Q00341 |
Protein Sequence | Synthetic peptide located within the following region: MSSVAVLTQESFAEHRSGLVPQQIKVATLNSEEESDPPTYKDAFPPLPEK |
NCBI | NP_005327 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | HBP, VGL, PRO2900 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
HDLBP was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb577672 with 1:200 dilution. Western blot was performed using orb577672 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole cell lysate. Lane 2: HDLBP IP with orb577672 in HEK293 Whole cell lysate. Lane 3: Input of HEK293 Whole cell lysate.
WB Suggested Anti-HDLBP Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate.
IF | |
Equine, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
FITC |
IHC-P, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |