HDLBP Rabbit Polyclonal Antibody

• Catalog Number: orb577672
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HDLBP
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HDLBP
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 141kDa
• Target: HDLBP
• UniProt ID: Q00341
• Protein Sequence: Synthetic peptide located within the following region: MSSVAVLTQESFAEHRSGLVPQQIKVATLNSEEESDPPTYKDAFPPLPEK
• NCBI: NP_005327
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HBP, VGL, PRO2900
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

HDLBP was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb577672 with 1:200 dilution. Western blot was performed using orb577672 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole cell lysate. Lane 2: HDLBP IP with orb577672 in HEK293 Whole cell lysate. Lane 3: Input of HEK293 Whole cell lysate.

WB Suggested Anti-HDLBP Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate.