HDLBP Rabbit Polyclonal Antibody

SKU: orb577672

Description

Rabbit polyclonal antibody to HDLBP

Research Area

Metabolism Research

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HDLBP
• Target: HDLBP
• Protein Sequence: Synthetic peptide located within the following region: MSSVAVLTQESFAEHRSGLVPQQIKVATLNSEEESDPPTYKDAFPPLPEK
• Molecular Weight: 141kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

HBP, VGL, PRO2900

HDLBP was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb577672 with 1:200 dilution. Western blot was performed using orb577672 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole cell lysate. Lane 2: HDLBP IP with orb577672 in HEK293 Whole cell lysate. Lane 3: Input of HEK293 Whole cell lysate.

WB Suggested Anti-HDLBP Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate.

Quick Database Links

Gene Symbol

HDLBP

UniProt

Q00341

RefSeq (Protein):NP_005327