Hdac6 antibody

• Catalog Number: orb576809
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Hdac6
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ChIP, IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Hdac6
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 126kDa
• Target: Hdac6
• UniProt ID: Q9Z2V5
• Protein Sequence: Synthetic peptide located within the following region: VCHHEASEHPLVLSCVDLSTWCYVCQAYVHHEDLQDVKNAAHQNKFGEDM
• NCBI: NP_034543
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Hd6, Sfc, Sfc6, mHDA, Hdac5, mHDA2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of Mouse Testis using Hdac6 antibody.

Western blot analysis of Mouse Spleen using Hdac6 antibody.

Immunofluorescence analysis of Human Adult heart using Hdac6 antibody.

Chromatography analysis of HCT116 Cells using antibody.