Hdac6 Rabbit Polyclonal Antibody

• Catalog Number: orb576809
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Hdac6
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ChIP, IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Hdac6
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 126kDa
• Target: Hdac6
• UniProt ID: Q9Z2V5
• Protein Sequence: Synthetic peptide located within the following region: VCHHEASEHPLVLSCVDLSTWCYVCQAYVHHEDLQDVKNAAHQNKFGEDM
• NCBI: NP_034543
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Hd6, Sfc, Sfc6, mHDA, Hdac5, mHDA2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Chromatin Immunoprecipitation (ChIP) Using Hdac6 Antibody - C-terminal region (orb576809) and HCT116 Cells.

Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/ml.

Rabbit Anti-Hdac6 Antibody, Catalog Number: orb576809, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-Hdac6 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Testis.