Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Hdac4 Rabbit Polyclonal Antibody

SKU: orb330319

Description

Hdac4 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Hdac4. It is suitable for ChIP, WB applications. The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Hdac4. This antibody reacts with Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Human, Rat, Yeast, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsChIP, WB
ReactivityMouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Rat, Yeast, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Hdac4
TargetHdac4
Protein SequenceSynthetic peptide located within the following region: SSTVGHSLIEAQKCEKEEAETVTAMASLSVGVKPAEKRSEEEPMEEEPPL
Molecular Weight118kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti 4932408F19Rik antibody, anti AI047285 antibody

Similar Products

  • HDAC4 Rabbit Polyclonal Antibody [orb18862]

    FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Phospho-HDAC4 (Ser246) + HDAC5 (Ser259) + HDAC7 (Ser155) Rabbit Polyclonal Antibody [orb6132]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Gallus, Rabbit, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-HDAC4 (Ser246) Rabbit Polyclonal Antibody [orb157455]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Gallus, Mouse, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-HDAC5 (Ser259) Rabbit Polyclonal Antibody [orb157458]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Gallus, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • HDAC4 rabbit pAb Antibody [orb765376]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Hdac4 Rabbit Polyclonal Antibody

Chromatin Immunoprecipitation (ChIP) Using Hdac4 Antibody - C-terminal region (orb330319) and HCT116 Cells.

Hdac4 Rabbit Polyclonal Antibody

Lanes: Lane 1: 40 ug mouse brain, synaptosome lysate, Lane 2: 40 ug mouse brain, membrane fraction, Lane 3: 40 ug mouse brain, cytoplasm fraction, Lane 4: 40 ug mouse brain, nuclear fraction, Lane 5: 40 ug mouse brain, post synaptic density fraction, Lane 6: 40 ug mouse brain, synaptosome lysate, Lane 7: 40 ug mouse brain, membrane fraction, Lane 8: 40 ug mouse brain, cytoplasm fraction, Lane 9: 40 ug mouse brain, nuclear fraction, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti-rabbit HRP, Secondary Antibody Dilution: 1:2000, Gene Name: Hdac4.

Hdac4 Rabbit Polyclonal Antibody

WB Suggested Anti-Hdac4 Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Liver.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_997108

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
ChIP
Chromatin Immunoprecipitation
View Protocol

Hdac4 Rabbit Polyclonal Antibody (orb330319)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry