Cart summary

You have no items in your shopping cart.

Hdac4 Rabbit Polyclonal Antibody

SKU: orb330319

Description

Rabbit polyclonal antibody to Hdac4

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsChIP, WB
ReactivityMouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Rat, Yeast, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Hdac4
TargetHdac4
Protein SequenceSynthetic peptide located within the following region: SSTVGHSLIEAQKCEKEEAETVTAMASLSVGVKPAEKRSEEEPMEEEPPL
Molecular Weight118kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti 4932408F19Rik antibody, anti AI047285 antibody

Similar Products

  • HDAC4 Rabbit Polyclonal Antibody [orb18862]

    FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Phospho-HDAC4 (Ser246) + HDAC5 (Ser259) + HDAC7 (Ser155) Rabbit Polyclonal Antibody [orb6132]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Gallus, Rabbit, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • HDAC4 rabbit pAb Antibody [orb765376]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • HDAC4 (phospho Ser632) rabbit pAb Antibody [orb764198]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • Phospho-HDAC4 (Ser246) Rabbit Polyclonal Antibody [orb157455]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Gallus, Mouse, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Hdac4 Rabbit Polyclonal Antibody

Chromatin Immunoprecipitation (ChIP) Using Hdac4 Antibody - C-terminal region (orb330319) and HCT116 Cells.

Hdac4 Rabbit Polyclonal Antibody

Lanes: Lane 1: 40 ug mouse brain, synaptosome lysate, Lane 2: 40 ug mouse brain, membrane fraction, Lane 3: 40 ug mouse brain, cytoplasm fraction, Lane 4: 40 ug mouse brain, nuclear fraction, Lane 5: 40 ug mouse brain, post synaptic density fraction, Lane 6: 40 ug mouse brain, synaptosome lysate, Lane 7: 40 ug mouse brain, membrane fraction, Lane 8: 40 ug mouse brain, cytoplasm fraction, Lane 9: 40 ug mouse brain, nuclear fraction, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti-rabbit HRP, Secondary Antibody Dilution: 1:2000, Gene Name: Hdac4.

Hdac4 Rabbit Polyclonal Antibody

WB Suggested Anti-Hdac4 Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Liver.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_997108

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
ChIP
Chromatin Immunoprecipitation
View Protocol

Hdac4 Rabbit Polyclonal Antibody (orb330319)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry