Hdac4 Rabbit Polyclonal Antibody

• Catalog Number: orb330319
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Hdac4
• Target: Hdac4
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rat, Yeast, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Hdac4
• Protein Sequence: Synthetic peptide located within the following region: SSTVGHSLIEAQKCEKEEAETVTAMASLSVGVKPAEKRSEEEPMEEEPPL
• UniProt ID: Q6NZM9
• MW: 118kDa
• Tested applications: ChIP, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti 4932408F19Rik antibody, anti AI047285 antibod
• Note: For research use only
• NCBI: NP_997108

Chromatin Immunoprecipitation (ChIP) Using Hdac4 Antibody - C-terminal region (orb330319) and HCT116 Cells.

Lanes: Lane 1: 40 ug mouse brain, synaptosome lysate, Lane 2: 40 ug mouse brain, membrane fraction, Lane 3: 40 ug mouse brain, cytoplasm fraction, Lane 4: 40 ug mouse brain, nuclear fraction, Lane 5: 40 ug mouse brain, post synaptic density fraction, Lane 6: 40 ug mouse brain, synaptosome lysate, Lane 7: 40 ug mouse brain, membrane fraction, Lane 8: 40 ug mouse brain, cytoplasm fraction, Lane 9: 40 ug mouse brain, nuclear fraction, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti-rabbit HRP, Secondary Antibody Dilution: 1:2000, Gene Name: Hdac4.

WB Suggested Anti-Hdac4 Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Liver.