Cart summary

You have no items in your shopping cart.

HDAC4 Rabbit Polyclonal Antibody

SKU: orb329767

Description

Rabbit polyclonal antibody to HDAC4

Research Area

Cell Biology, Epigenetics & Chromatin, Immunology & Inflammation, Neuroscience, Protein Biochemistry, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Guinea pig, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human HDAC4
TargetHDAC4
Protein SequenceSynthetic peptide located within the following region: YLDRLPGQKEAHAQAGVQVKQEPIESDEEEAEPPREVEPGQRQPSEQELL
Molecular Weight119kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti HA6116 antibody, anti HD4 antibody, anti HDAC-A antibody, anti HDACA antibody, anti KIAA0288 antibody, anti AHO3 antibody, anti BDMR antibody, anti HDAC-4 antibody

Similar Products

  • HDAC4 Rabbit Polyclonal Antibody [orb18862]

    FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Phospho-HDAC4 (Ser246) + HDAC5 (Ser259) + HDAC7 (Ser155) Rabbit Polyclonal Antibody [orb6132]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Gallus, Rabbit, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • HDAC4 (phospho Ser632) rabbit pAb Antibody [orb764198]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • HDAC4 rabbit pAb Antibody [orb765376]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • Phospho-HDAC4 (Ser246) Rabbit Polyclonal Antibody [orb157455]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Gallus, Mouse, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

HDAC4 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/mL.

HDAC4 Rabbit Polyclonal Antibody

Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/mL.

HDAC4 Rabbit Polyclonal Antibody

WB Suggested Anti-HDAC4 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: Hela cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_006028

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

HDAC4 Rabbit Polyclonal Antibody (orb329767)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry