HDAC4 Rabbit Polyclonal Antibody

• Catalog Number: orb329767
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HDAC4
• Target: HDAC4
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Guinea pig, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HDAC4
• Protein Sequence: Synthetic peptide located within the following region: YLDRLPGQKEAHAQAGVQVKQEPIESDEEEAEPPREVEPGQRQPSEQELL
• UniProt ID: P56524
• MW: 119kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti HA6116 antibody, anti HD4 antibody, anti HDAC
• Note: For research use only
• NCBI: NP_006028

Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/mL.

WB Suggested Anti-HDAC4 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: Hela cell lysate.