You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574159 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to HDAC1 |
Target | HDAC1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human HDAC1 |
Protein Sequence | Synthetic peptide located within the following region: EKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICS |
UniProt ID | Q13547 |
MW | 55kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | HD1, RPD3, KDAC1, GON-10, RPD3L1 |
Note | For research use only |
NCBI | NP_004955 |
Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.
Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.
Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
Rabbit Anti-HDAC1 antibody, Catalog Number: orb574159, Paraffin Embedded Tissue: Human Heart cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-HDAC1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:2500, Positive Control: Jurkat cell lysate, HDAC1 is supported by BioGPS gene expression data to be expressed in Jurkat.
ICC, IF, IHC-Fr, IHC-P, WB | |
Mouse | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Porcine, Rat, Sheep | |
Guinea pig, Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IH, WB | |
Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |