You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
HCAR2 Rabbit Polyclonal Antibody
Catalog Number: orb331249
| Catalog Number | orb331249 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to Interferon gamma |
| Target | HCAR2 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Guinea pig, Mouse, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Protein Sequence | Synthetic peptide located within the following region: YYFSSPSFPNFFSTLINRCLQRKMTGEPDNNRSTSVELTGDPNKTRGAPE |
| UniProt ID | Q8TDS4 |
| MW | 42kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | HCA2, HM74a, HM74b, PUMAG, NIACR1, Puma-g, GPR109A |
| Note | For research use only |
| NCBI | NP_808219 |
Sample Tissue: Human Stomach Tumor, Antibody dilution: 1.0 ug/ml.
WB Suggested Anti-HCAR2 Antibody, Titration: 1.0 ug/ml, Positive Control: MCF7 Whole Cell.
- Item 1 of 3
Anti-GPR109A Antibody [orb665817]
IF, IH, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
30 μl, 200 μl, 100 μl - Item 1 of 1
- Item 1 of 1
- Item 1 of 1
HCAR2 Rabbit Polyclonal Antibody (HRP) [orb2093117]
WB
Bovine, Guinea pig, Human, Mouse, Rabbit, Rat
Rabbit
Polyclonal
HRP
100 μl
