HBS1L Rabbit Polyclonal Antibody

• Catalog Number: orb581614
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HBS1L
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HBS1L
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 22kDa
• Target: HBS1L
• UniProt ID: Q9Y450
• Protein Sequence: Synthetic peptide located within the following region: MNHKILVCFADQGSGFCITGKIEAGYIQTGDRLLAMPPNETCTVKGITLH
• NCBI: EAW47980
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ERFS, HBS1, EF-1a, eRF3c, HSPC276
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-HBS1L Antibody, Catalog Number: orb581614, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm in hepatocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-HBS1L Antibody Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.