Cart summary

You have no items in your shopping cart.

HAUS8 Rabbit Polyclonal Antibody (Biotin)

HAUS8 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2098066

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2098066
CategoryAntibodies
DescriptionHAUS8 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityHuman, Porcine
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HAUS8
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW45kDa
UniProt IDQ9BT25
Protein SequenceSynthetic peptide located within the following region: QTRGKMSEGGRKSSLLQKSKADSSGVGKGDLQSTLLEGHGTAPPDLDLSA
NCBINP_219485
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesDGT4, HICE1, NY-SAR-48
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.