Cart summary

You have no items in your shopping cart.

HAUS7 Rabbit Polyclonal Antibody (Biotin)

HAUS7 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2102419

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2102419
CategoryAntibodies
DescriptionHAUS7 Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityBovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human HAUS7
Protein SequenceSynthetic peptide located within the following region: DLNCPFLEGLYITEPKTIQELLCSPSEYRLEILEWMCTRVWPSLQDRFSS
UniProt IDQ99871
MW37kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesUIP1, UCHL5IP
NoteFor research use only