You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb326670 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to H2AFV |
Target | H2AFV |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human H2AFV |
Protein Sequence | Synthetic peptide located within the following region: MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGAT |
UniProt ID | A6NKY0 |
MW | 10kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti FLJ26479 antibody, anti H2AV antibody, anti M Read more... |
Note | For research use only |
NCBI | NP_036544 |
Sample Type: 293T Whole Cell lysates, Antibody Dilution: 1.0 ug/mL. There is BioGPS gene expression data showing that H2AFV is expressed in HEK293T.
ELISA, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Gallus, Human, Mouse, Porcine, Rat, Xenopus, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF | |
Bovine, Canine, Equine, Gallus, Human, Mouse, Porcine, Rat, Xenopus, Zebrafish | |
Rabbit | |
Polyclonal | |
FITC |
ICC, IF | |
Bovine, Canine, Equine, Gallus, Human, Mouse, Porcine, Rat, Xenopus, Zebrafish | |
Rabbit | |
Polyclonal | |
PE |