H2AFV Rabbit Polyclonal Antibody

• Catalog Number: orb326670
• Category: Antibodies
• Description: Rabbit polyclonal antibody to H2AFV
• Target: H2AFV
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human H2AFV
• Protein Sequence: Synthetic peptide located within the following region: MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGAT
• UniProt ID: A6NKY0
• MW: 10kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti FLJ26479 antibody, anti H2AV antibody, anti M
• Note: For research use only
• NCBI: NP_036544

Sample Type: 293T Whole Cell lysates, Antibody Dilution: 1.0 ug/mL. There is BioGPS gene expression data showing that H2AFV is expressed in HEK293T.