GTF2IRD1 Rabbit Polyclonal Antibody

• Catalog Number: orb329740
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GTF2IRD1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GTF2IRD1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 106kDa
• Target: GTF2IRD1
• UniProt ID: Q9UHL9
• Protein Sequence: Synthetic peptide located within the following region: TFGSQNLERILAVADKIKFTVTRPFQGLIPKPDEDDANRLGEKVILREQV
• NCBI: NP_057412
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti CREAM1 antibody, anti GTF3 antibody, anti MUS
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human kidney

WB Suggested Anti-GTF2IRD1 Antibody Titration: 2.5 ug/mL, Positive Control: Transfected 293T.