You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb573957 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GTF2I |
Target | GTF2I |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GTF2I |
Protein Sequence | Synthetic peptide located within the following region: ILSPGGSCGPIKVKTEPTEDSGISLEMAAVTVKEESEDPDYYQYNIQGSH |
UniProt ID | Q75M85 |
MW | 108kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | WBS, DIWS, SPIN, IB291, BAP135, BTKAP1, TFII-I, WB Read more... |
Note | For research use only |
NCBI | NP_001509 |
Rabbit Anti-GTF21 Antibody, Paraffin Embedded Tissue: Human Pancreas, Cellular Data: Epithelial cells of pancreatic acinus, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
Rabbit Anti-GTF21 Antibody, Paraffin Embedded Tissue: Human Skin, Cellular Data: Squamous epithelial cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-GTF2I Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2. There is BioGPS gene expression data showing that GTF2I is expressed in HepG2.
WB Suggested Anti-GTF2I Antibody, Titration: 2.5 ug/ml, Positive Control: HepG2 Whole Cell, There is BioGPS gene expression data showing that GTF2I is expressed in HepG2.
FC, IF, IHC-P, WB | |
Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |