GTF2I Rabbit Polyclonal Antibody

• Catalog Number: orb573957
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GTF2I
• Target: GTF2I
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GTF2I
• Protein Sequence: Synthetic peptide located within the following region: ILSPGGSCGPIKVKTEPTEDSGISLEMAAVTVKEESEDPDYYQYNIQGSH
• UniProt ID: Q75M85
• MW: 108kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: WBS, DIWS, SPIN, IB291, BAP135, BTKAP1, TFII-I, WB
• Research Area: Epigenetics & Chromatin, Signal Transduction, Stem
• Note: For research use only
• NCBI: NP_001509

Rabbit Anti-GTF21 Antibody, Paraffin Embedded Tissue: Human Pancreas, Cellular Data: Epithelial cells of pancreatic acinus, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Rabbit Anti-GTF21 Antibody, Paraffin Embedded Tissue: Human Skin, Cellular Data: Squamous epithelial cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-GTF2I Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2. There is BioGPS gene expression data showing that GTF2I is expressed in HepG2.

WB Suggested Anti-GTF2I Antibody, Titration: 2.5 ug/ml, Positive Control: HepG2 Whole Cell, There is BioGPS gene expression data showing that GTF2I is expressed in HepG2.