GTF2H3 Rabbit Polyclonal Antibody

• Catalog Number: orb573798
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GTF2H3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GTF2H3
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 34kDa
• Target: GTF2H3
• UniProt ID: Q13889
• Protein Sequence: Synthetic peptide located within the following region: VIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSAN
• NCBI: NP_001507
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: P34, BTF2, TFB4, TFIIH
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human Muscle

Rabbit Anti-GTF2H3 antibody, Paraffin Embedded Tissue: Human Heart, cell Cellular Data: cardiac cell, Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.

WB Suggested Anti-GTF2H3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:2500, Positive Control: Jurkat cell lysate, GTF2H3 is supported by BioGPS gene expression data to be expressed in Jurkat.