You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb573798 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to GTF2H3 |
| Target | GTF2H3 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GTF2H3 |
| Protein Sequence | Synthetic peptide located within the following region: VIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSAN |
| UniProt ID | Q13889 |
| MW | 34kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | P34, BTF2, TFB4, TFIIH |
| Research Area | Epigenetics & Chromatin, Molecular Biology |
| Note | For research use only |
| NCBI | NP_001507 |

Human Muscle

Rabbit Anti-GTF2H3 antibody, Paraffin Embedded Tissue: Human Heart, cell Cellular Data: cardiac cell, Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.

WB Suggested Anti-GTF2H3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:2500, Positive Control: Jurkat cell lysate, GTF2H3 is supported by BioGPS gene expression data to be expressed in Jurkat.
WB | |
Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Equine, Guinea pig, Human, Rabbit, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF | |
Bovine, Canine, Chinese Hamster, Equine, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
APC |
ICC, IF | |
Bovine, Canine, Chinese Hamster, Equine, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Cy5.5 |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review