GTF2H1 Rabbit Polyclonal Antibody

• Catalog Number: orb592886
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GTF2H1
• Target: GTF2H1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Equine, Guinea pig, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GTF2H1
• Protein Sequence: Synthetic peptide located within the following region: EEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKI
• UniProt ID: P32780
• MW: 62kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: P62, BTF2, TFB1, TFIIH
• Research Area: Cell Biology, Epigenetics & Chromatin, Molecular B
• Note: For research use only
• NCBI: NP_005307

Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/ml.

Human kidney

Human Liver

WB Suggested Anti-GTF2H1 Antibody Titration: 1.0-2.0 ug/ml, Positive Control: Daudi cell lysate. GTF2H1 is supported by BioGPS gene expression data to be expressed in Daudi.