You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb592886 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GTF2H1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Equine, Guinea pig, Rat, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GTF2H1 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 62kDa |
Target | GTF2H1 |
UniProt ID | P32780 |
Protein Sequence | Synthetic peptide located within the following region: EEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKI |
NCBI | NP_005307 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | P62, BTF2, TFB1, TFIIH Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/ml.
Human kidney
Human Liver
WB Suggested Anti-GTF2H1 Antibody Titration: 1.0-2.0 ug/ml, Positive Control: Daudi cell lysate. GTF2H1 is supported by BioGPS gene expression data to be expressed in Daudi.
IH, WB | |
Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Rat, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |