You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human, Mouse |
| Predicted Reactivity | Equine, Guinea pig, Rat, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GTF2H1 |
| Target | GTF2H1 |
| Protein Sequence | Synthetic peptide located within the following region: EEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKI |
| Molecular Weight | 62kDa |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−GTF2H1 Rabbit Polyclonal Antibody [orb592941]
WB
Bovine, Canine, Equine, Guinea pig, Rat, Zebrafish
Human, Mouse
Rabbit
Polyclonal
Unconjugated
100 μlGTF2H1 Rabbit Polyclonal Antibody [orb318932]
IHC, WB
Canine, Human, Mouse, Porcine, Rat
Rabbit
Polyclonal
Unconjugated
30 μl, 100 μl, 200 μl, 50 μlGTF2H1 Rabbit Polyclonal Antibody [orb627564]
ELISA, WB
Human, Mouse
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/ml.

Human kidney

Human Liver

WB Suggested Anti-GTF2H1 Antibody Titration: 1.0-2.0 ug/ml, Positive Control: Daudi cell lysate. GTF2H1 is supported by BioGPS gene expression data to be expressed in Daudi.
Documents Download
Request a Document
Protocol Information
GTF2H1 Rabbit Polyclonal Antibody (orb592886)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review






