You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576528 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GTF2F1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GTF2F1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 58kDa |
Target | GTF2F1 |
UniProt ID | P35269 |
Protein Sequence | Synthetic peptide located within the following region: DKVNFATWNQARLERDLSNKKIYQEEEMPESGAGSEFNRKLREEARRKKY |
NCBI | NP_002087 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | BTF4, RAP74, TF2F1, TFIIF Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Rabbit Anti-GTF2F1 antibody, Catalog Number: orb576528, Paraffin Embedded Tissue: Human Lung cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-GTF2F1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: HT1080 cell lysate. GTF2F1 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells.
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Canine, Guinea pig, Mouse, Rabbit, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast | |
Rabbit | |
Polyclonal | |
FITC |