GTF2B Rabbit Polyclonal Antibody

• Catalog Number: orb592969
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GTF2B
• Target: GTF2B
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Rat
• Predicted Reactivity: Canine, Equine, Guinea pig, Mouse, Rabbit, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GTF2B
• Protein Sequence: Synthetic peptide located within the following region: NLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFK
• UniProt ID: Q00403
• MW: 35kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: TF2B, TFIIB
• Research Area: Epigenetics & Chromatin, Protein Biochemistry
• Note: For research use only
• NCBI: NP_001505
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/ml.

Human Intestine

WB Suggested Anti-GTF2B Antibody Titration: 4.0 ug/ml, Positive Control: HepG2 cell lysate.