GSTM3 Rabbit Polyclonal Antibody

• Catalog Number: orb330711
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GSTM3
• Target: GSTM3
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GSTM3
• Protein Sequence: Synthetic peptide located within the following region: EEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMF
• UniProt ID: P21266
• MW: 27 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti GST5 antibody, anti GSTB antibody, anti GSTM3
• Research Area: Neuroscience
• Note: For research use only
• NCBI: NP_000840

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 0.2 ug/ml.

Sample Tissue: Human Stomach Tumor, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-GSTM3 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.