Cart summary

You have no items in your shopping cart.

GSTA5 Rabbit Polyclonal Antibody (FITC)

GSTA5 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2113491

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2113491
CategoryAntibodies
DescriptionGSTA5 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human GSTA5
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW26kDa
UniProt IDQ7RTV2
Protein SequenceSynthetic peptide located within the following region: QPEERDAKTALVKEKIKNRYFPAFEKVLKSHRQDYLVGNKLSWADIHLVE
NCBINP_714543
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
NoteFor research use only
Expiration Date12 months from date of receipt.