GSR Rabbit Polyclonal Antibody

• Catalog Number: orb582295
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GSR
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat
• Reactivity: Human, Mouse, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GSR
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 56kDa
• Target: GSR
• UniProt ID: P00390
• Protein Sequence: Synthetic peptide located within the following region: PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP
• NCBI: NP_000628
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: GR, GSRD, HEL-75, HEL-S-122m
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Type: HepG2, Antibody dilution: 1.0 ug/ml. GSR is supported by BioGPS gene expression data to be expressed in HepG2.

Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. GSR is supported by BioGPS gene expression data to be expressed in 721_B.

Lanes: 1: 40 ug mouse heart lysate, 2: 40 ug mouse skeletal muscle lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:10000, Gene Name: GSR.

Rabbit Anti-GSR Antibody, Catalog Number: orb582295, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-GSR Antibody, Positive Control: Lane 1: 10 ug untreated zebrafish head lysate, Lane 2: 10 ug 3hr H2O2 treated zebrafish head lysate, Lane 3: 10 ug 6hr H2O2 treated zebrafish head lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti rabbit-HRP, Secondry Antibody Dilution: 1:10000.

WB Suggested Anti-GSR Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Hela cell lysate.